RAD17 anticorps

N° du produit ABIN631819

Cet anticorps Lapin Polyclonal détecte spécifiquement RAD17 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour RAD17 anticorps (ABIN631819)

Antigène: RAD17

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAD17 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RAD17 anticorps

Purification: Affinity purified

Immunogène: RAD17 antibody was raised using a synthetic peptide corresponding to a region with amino acids MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAD17 Blocking Peptide, (ABIN5615727), is also available for use as a blocking control in assays to test for specificity of this RAD17 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAD17

Antigène: RAD17

Autre désignation: RAD17

Sujet: RAD17 is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs.

Poids moléculaire: 76 kDa (MW of target protein)